CNPY3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7176
Zusätzliche Namen:: CAG4A|CNPY3|DEE60|EIEE60|ERDA5|PRAT4A|TNRC5
Anwendung:: ELISA, WB, IHC-P, IP
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL
Uniprot:: Q9BT09
Synonyme:: CAG repeat containing;CAG4A;CTG repeat protein 4a;DEE60;EIEE60;ERDA5;expanded repeat-domain protein CAG/CTG 5;PRAT4A;protein associated with TLR4;protein associated with Toll-like receptor 4A;protein canopy homolog 3;TNRC5;trinucleotide repeat-containing gene 5 protein
Weitere Details:: This gene encodes a protein that binds members of the toll-like receptor protein family and functions as a chaperone to aid in folding and export of these proteins. Alternative splicing results in multiple transcript variants. Naturally occuring readthrough transcription occurs between this locus and the downstream GNMT (glycine N-methyltransferase) gene and is represented with GeneID:107080644.