A7140
CARD11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7140
- Zusätzliche Namen:
- BENTA|BIMP3|CARD11|CARMA1|IMD11|IMD11A|PPBL
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 133kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL
- Uniprot:
- Q9BXL7
- Synonyme:
- bcl10-interacting maguk protein 3;BENTA;BIMP3;CARD-containing MAGUK protein 1;carma 1;CARMA1;caspase recruitment domain-containing protein 11;IMD11;IMD11A;PPBL
- Weitere Details:
- The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10.
- Versandbedingungen:
- Blue Ice



