ELAC2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7128
Zusätzliche Namen:: COXPD17|ELAC2|ELC2|HPC2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 105kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGGLSGMILTLKETGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSESNENEPHLPHGVSQRRGVRDSSLVVAFICKLHLKRGNFLVLKAKEMGLPVGTAA
Uniprot:: Q9BQ52
Synonyme:: COXPD17;elaC homolog 2;elaC homolog protein 2;elaC-like protein 2;ELC2;heredity prostate cancer protein 2;HPC2;putative prostate cancer susceptibility protein HPC2/ELAC2;ribonuclease Z 2;RNase Z 2;tRNA 3 endonuclease 2;tRNase Z (long form);tRNase Z 2;zinc phosphodiesterase ELAC protein 2
Weitere Details:: The protein encoded by this gene has a C-terminal domain with tRNA 3′ processing endoribonuclease activity, which catalyzes the removal of the 3' trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest. Mutations in this gene result in an increased risk of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice