A7116
TRMT1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7116
- Zusätzliche Namen:
- MRT68|TRM1|TRMT1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 90kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID
- Uniprot:
- Q9NXH9
- Synonyme:
- MRT68;N(2),N(2)-dimethylguanosine tRNA methyltransferase;TRM1;TRM1 tRNA methyltransferase 1 homolog;tRNA (guanine(26)-N(2))-dimethyltransferase;tRNA 2,2-dimethylguanosine-26 methyltransferase;tRNA methyltransferase 1 homolog;tRNA(guanine-26,N(2)-N(2)) methyltransferase;tRNA(m(2,2)G26)dimethyltransferase
- Weitere Details:
- This gene encodes a tRNA-modifying enzyme that acts as a dimethyltransferase, modifying a single guanine residue at position 26 of the tRNA. The encoded enzyme has both mono- and dimethylase activity when exogenously expressed, and uses S-adenosyl methionine as a methyl donor. The C-terminal region of the encoded protein has both a zinc finger motif, and an arginine/proline-rich region. Mutations in this gene have been implicated in autosomal recessive intellectual disorder (ARID). Alternative splicing results in multiple transcript variants encoding different isoforms. There is a pseudogene of this gene on the X chromosome.
- Versandbedingungen:
- Blue Ice

