A7113
DPP8 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7113
- Zusätzliche Namen:
- DP8|DPP8|DPRP-1|DPRP1|MST097|MSTP097|MSTP135|MSTP141
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 103kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAF
- Uniprot:
- Q6V1X1
- Synonyme:
- dipeptidyl peptidase 8;dipeptidyl peptidase IV-related protein 1;dipeptidyl peptidase VIII;DP8;DPP VIII;DPRP-1;DPRP1;MST097;MSTP097;MSTP135;MSTP141;prolyl dipeptidase DPP8
- Weitere Details:
- This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice