A7112
NDE1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7112
- Zusätzliche Namen:
- HOM-TES-87|LIS4|MHAC|NDE|NDE1|NUDE|NUDE1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 39kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL
- Uniprot:
- Q9NXR1
- Synonyme:
- epididymis secretory sperm binding protein;HOM-TES-87;LIS1-interacting protein NUDE1, rat homolog;LIS4;MHAC;NDE;nuclear distribution protein nudE homolog 1;NUDE;nudE nuclear distribution E homolog 1;nudE nuclear distribution gene E homolog 1;NUDE1
- Weitere Details:
- This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice