METTL13 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7111
Zusätzliche Namen:: 5630401D24Rik|CGI-01|DFNB26|DFNB26M|DFNM1|EEF1AKNMT|feat|KIAA0859|METTL13
Anwendung:: ELISA, WB
Molekulargewicht:: 90 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
Uniprot:: Q8N6R0
Synonyme:: 5630401D24Rik;antiapoptotic protein FEAT;CGI-01;deafness (autosomal recessive, nonsyndromic) modifier 1;deafness (recessive, non-syndromic) modifier 1;deafness (recessive, nonsyndromic) modifier 1;DFNB26;DFNB26M;DFNM1;eEF1A lysine and N-terminal methyltransferase;eEF1A-KNMT;EEF1AKNMT;faint expression in normal tissues, aberrant overexpression in tumors;feat;KIAA0859;methyltransferase like 13;methyltransferase-like protein 13
Weitere Details:: Predicted to enable methyltransferase activity. Involved in negative regulation of cell cycle G1/S phase transition and negative regulation of transcription by RNA polymerase II. Predicted to be located in mitochondrion and nucleus.