A7100
KCNIP2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7100
- Zusätzliche Namen:
- KCHIP2|KCNIP2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ
- Uniprot:
- Q9NS61
- Synonyme:
- A-type potassium channel modulatory protein 2;cardiac voltage-gated potassium channel modulatory subunit;KCHIP2;Kv channel interacting protein 2;Kv channel-interacting protein 2;potassium channel-interacting protein 2
- Weitere Details:
- This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
- Versandbedingungen:
- Blue Ice