C16orf80 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7099
Zusätzliche Namen:: BUG22|C16orf80|EVORF|fSAP23|GTL3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Uniprot:: Q9Y6A4
Synonyme:: basal body up-regulated protein 22;BUG22;C16orf80;cilia- and flagella-associated protein 20;EVORF;flagellar associated protein 20 homolog;fSAP23;functional spliceosome-associated protein 23;gene trap locus 3;GTL3;transcription factor IIB;UPF0468 protein C16orf80
Weitere Details:: Enables RNA binding activity. Involved in several processes, including positive regulation of feeding behavior; protein polyglutamylation; and regulation of cell motility. Located in centriole; ciliary basal body; and nucleoplasm.