A7097
NFU1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7097
- Zusätzliche Namen:
- CGI-33|HIRIP|HIRIP5|MMDFS|MMDS1|Nfu|NFU1|NifU|NIFUC
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25-28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF
- Uniprot:
- Q9UMS0
- Synonyme:
- CGI-33;HIRA-interacting protein 5;HIRIP;HIRIP5;iron-sulfur cluster scaffold protein;MMDS1;Nfu;NFU1 iron-sulfur cluster scaffold homolog, mitochondrial;NifU;NifU-like C-terminal domain containing;NIFUC
- Weitere Details:
- This gene encodes a protein that is localized to mitochondria and plays a critical role in iron-sulfur cluster biogenesis. The encoded protein assembles and transfers 4Fe-4S clusters to target apoproteins including succinate dehydrogenase and lipoic acid synthase. Mutations in this gene are a cause of multiple mitochondrial dysfunctions syndrome-1, and pseudogenes of this gene are located on the short arms of chromosomes 1 and 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice