A7091
UPF2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7091
- Zusätzliche Namen:
- HUPF2|RENT2|smg-3|UPF2
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 170kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR
- Uniprot:
- Q9HAU5
- Synonyme:
- FRS2/UPF2/LEMD3 fusion;HUPF2;LEMD3/UPF2 fusion;nonsense mRNA reducing factor 2;regulator of nonsense transcripts 2;RENT2;smg-3;smg-3 homolog, nonsense mediated mRNA decay factor;up-frameshift suppressor 2 homolog;UPF2 regulator of nonsense transcripts homolog;yeast Upf2p homolog
- Weitere Details:
- This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene; both variants encode the same protein.
- Versandbedingungen:
- Blue Ice