MORF4L1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7071
Zusätzliche Namen:: Eaf3|FWP006|HsT17725|MEAF3|MORF4L1|MORFRG15|MRG15|S863-6
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
Uniprot:: Q9UBU8
Synonyme:: Eaf3;Esa1p-associated factor 3 homolog;FWP006;HsT17725;MEAF3;MORF-related gene 15 protein;MORF-related gene on chromosome 15;MORFRG15;mortality factor 4-like protein 1;MRG15;protein MSL3-1;S863-6;transcription factor-like protein MRG15
Weitere Details:: Enables protein N-terminus binding activity. Involved in double-strand break repair via homologous recombination and histone modification. Located in nuclear speck. Part of NuA4 histone acetyltransferase complex and Sin3 complex.