AGR2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7064
Zusätzliche Namen:: AG-2|AG2|AGR2|GOB-4|HAG-2|HEL-S-116|HPC8|PDIA17|RIFTD|XAG-2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Uniprot:: O95994
Synonyme:: AG-2;AG2;anterior gradient homolog 2;anterior gradient protein 2 homolog;epididymis secretory protein Li 116;GOB-4;HAG-2;HEL-S-116;HPC8;PDIA17;protein disulfide isomerase family A, member 17;secreted cement gland homolog;secreted cement gland protein XAG-2 homolog;XAG-2
Weitere Details:: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression.

Versandbedingungen:: Blue Ice