BAP31 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7056
Zusätzliche Namen:: 6C6-AG|BAP31|CDM|DDCH|DELXQ28|DXS1357E|MICRODELXq28
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Uniprot:: P51572
Synonyme:: 6C6-AG;6C6-AG tumor-associated antigen;B-cell receptor-associated protein 31;BAP31;BCR-associated protein Bap31;CDM;DDCH;DXS1357E;p28;p28 Bap31;Protein CDM
Weitere Details:: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.