A7055
PDIA6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7055
- Zusätzliche Namen:
- ERP5|P5|PDIA6|TXNDC7
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
- Uniprot:
- Q15084
- Synonyme:
- endoplasmic reticulum protein 5;epididymis secretory sperm binding protein;ER protein 5;ERP5;P5;protein disulfide isomerase P5;protein disulfide isomerase-associated 6;protein disulfide isomerase-related protein;protein disulfide-isomerase A6;thioredoxin domain containing 7 (protein disulfide isomerase);thioredoxin domain-containing protein 7;TXNDC7
- Weitere Details:
- This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. This protein inhibits the aggregation of misfolded proteins and exhibits both isomerase and chaperone activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice





