A7045
[KO Validated] macroH2A.1 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A7045
- Zusätzliche Namen:
- 1|H2A.y|H2A/y|H2AF12M|H2AFY|MACROH2A1.1|macroH2A1.2|mH2A1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
- Uniprot:
- O75367
- Synonyme:
- core histone macro-H2A.1;H2A histone family member Y;H2A.y;H2A/y;H2AF12M;H2AFY;histone H2A.y;histone macroH2A1;histone macroH2A1.1;histone macroH2A1.2;MACROH2A1.1;macroH2A1.2;medulloblastoma antigen MU-MB-50.205;mH2A1
- Weitere Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_1.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_2.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_3.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_4.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_5.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_P3316_KO-WB_01.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_P3315_IHC_01.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_P3315_IHC_02.jpg)
![[KO Validated] macroH2A.1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A7045/A7045_P3315_IHC_03.jpg)