A7020
NPFF Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7020
- Zusätzliche Namen:
- FMRFAL|NPFF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
- Uniprot:
- O15130
- Synonyme:
- FMRFAL;FMRFamide-related peptides;pro-FMRFamide-related neuropeptide FF
- Weitere Details:
- This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
- Versandbedingungen:
- Blue Ice