A6998
UBE2V2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6998
- Zusätzliche Namen:
- DDVit-1|DDVIT1|EDAF-1|EDPF-1|EDPF1|MMS2|UBE2V2|UEV-2|UEV2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
- Uniprot:
- Q15819
- Synonyme:
- 1 alpha,25-dihydroxyvitamin D3-inducible;DDVit 1;DDVit-1;DDVIT1;EDAF-1;EDPF-1;EDPF1;enterocyte differentiation promoting factor;enterocyte differentiation-associated factor 1;enterocyte differentiation-associated factor EDAF-1;enterocyte differentiation-promoting factor 1;methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of;MMS2;MMS2 homolog;ubiquitin-conjugating enzyme E2 variant 2;UEV-2;UEV2;vitamin D3-inducible protein
- Weitere Details:
- Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
- Versandbedingungen:
- Blue Ice



