SLC1A5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6981
Zusätzliche Namen:: AAAT|ASCT2|ATBO|M7V1|M7VS1|R16|RDRC|SLC1A5
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ
Uniprot:: Q15758
Synonyme:: AAAT;ASCT2;ATB(0);ATBO;baboon M7 virus receptor;M7V1;M7VS1;neutral amino acid transporter B;neutral amino acid transporter B(0);R16;RD114 virus receptor;RD114/simian type D retrovirus receptor;RDRC;sodium-dependent neutral amino acid transporter type 2;solute carrier family 1 (neutral amino acid transporter), member 5;Solute carrier family 1 member 5
Weitere Details:: The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).