Cyclophilin 40 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6949
Zusätzliche Namen:: Cyclophilin 40|CYP-40|CYPD
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
Uniprot:: Q08752
Synonyme:: 40 kDa peptidyl-prolyl cis-trans isomerase;40 kDa peptidyl-prolyl cis-trans isomerase D;cyclophilin 40;cyclophilin D;Cyclophilin-40;cyclophilin-related protein;CYP-40;CYPD;peptidyl-prolyl cis-trans isomerase D;PPIase D;rotamase D;testicular tissue protein Li 147
Weitere Details:: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.