MYH1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6935
Zusätzliche Namen:: HEL71|MYH1|MYHa|MyHC-2x|MyHC-2X/D|MYHSA1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 251 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP
Uniprot:: P12882
Synonyme:: epididymis luminal protein 71;HEL71;MYHa;MyHC-2x;MyHC-2X/D;myHC-IIx/d;MYHSA1;Myosin heavy chain 1;myosin heavy chain 2x;myosin heavy chain IIx/d;myosin heavy chain, skeletal muscle, adult 1;myosin-1;myosin, heavy chain 1, skeletal muscle, adult;myosin, heavy polypeptide 1, skeletal muscle, adult
Weitere Details:: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin heavy chains are encoded by a multigene family. In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and nonmuscle cells. These isoforms show expression that is spatially and temporally regulated during development.