HOXB7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6925
Zusätzliche Namen:: HHO.C1|Hox-2.3|HOX2|HOX2C|HOXB7
Anwendung:: ELISA, WB
Molekulargewicht:: 24kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Uniprot:: P09629
Synonyme:: HHO.C1;homeo box 2C;homeo box B7;homeo box c1 protein;homeobox protein HHO.C1;homeobox protein Hox-2C;homeobox protein Hox-B7;Hox-2.3;HOX2;HOX2C
Weitere Details:: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.