A6897
DEFA1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6897
- Zusätzliche Namen:
- DEF1|DEFA1|DEFA2|HNP-1|HP-1|HP1|MRS
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 10kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
- Uniprot:
- P59665
- Synonyme:
- DEF1;DEFA2;Defensin, alpha 1;defensin, alpha 1, myeloid-related sequence;defensin, alpha 2;HNP-1;HP-1;HP1;MRS;myeloid-related sequence;neutrophil defensin 1
- Weitere Details:
- Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.
- Versandbedingungen:
- Blue Ice