CRY2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6891
Zusätzliche Namen:: CRY2|HCRY2|PHLL2
Anwendung:: ELISA, WB
Molekulargewicht:: 67 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNST
Uniprot:: Q49AN0
Synonyme:: cryptochrome 2 (photolyase-like);cryptochrome circadian clock 2;cryptochrome-2;growth-inhibiting protein 37;HCRY2;PHLL2
Weitere Details:: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.