ERCC8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6884
Zusätzliche Namen:: CKN1|CSA|ERCC8|UVSS2
Anwendung:: ELISA, WB
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
Uniprot:: Q13216
Synonyme:: CKN1;cockayne syndrome WD repeat protein CSA;Cockayne syndrome WD-repeat protein CSA;CSA;DNA excision repair protein ERCC-8;excision repair cross-complementation group 8;excision repair cross-complementing rodent repair deficiency, complementation group 8;UVSS2
Weitere Details:: This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. Several transcript variants encoding different isoforms have been found for this gene.