A6883
Septin 7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6883
- Zusätzliche Namen:
- CDC10|CDC3|NBLA02942|SEPT7|SEPT7A|Septin 7
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 51kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
- Uniprot:
- Q16181
- Synonyme:
- CDC10;CDC10 (cell division cycle 10, S. cerevisiae, homolog);CDC10 protein homolog;CDC3;NBLA02942;SEPT7;SEPT7A;septin 7 variant 4;septin-7
- Weitere Details:
- This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19.
- Versandbedingungen:
- Blue Ice