A6874
ATOX1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6874
- Zusätzliche Namen:
- ATOX1|ATX1|HAH1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
- Uniprot:
- O00244
- Synonyme:
- ATX1;ATX1 antioxidant protein 1 homolog;copper transport protein ATOX1;HAH1;metal transport protein ATX1
- Weitere Details:
- This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
- Versandbedingungen:
- Blue Ice