ALPPL2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6866
Zusätzliche Namen:: ALPPL|ALPPL2|GCAP
Anwendung:: ELISA, WB
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS
Uniprot:: P10696
Synonyme:: alkaline phosphatase Nagao isozyme;alkaline phosphatase, germ cell type;alkaline phosphatase, placental like 2;alkaline phosphatase, placental-like;ALP-1;ALPPL;ALPPL2;GCAP;germ cell alkaline phosphatase;Nagao isozyme;Placental alkaline phosphatase-like;placental-like alkaline phosphatase;testicular and thymus alkaline phosphatase
Weitere Details:: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.