ALOX15B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6865
Zusätzliche Namen:: 15-LOX-2|ALOX15B
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 73 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGL
Uniprot:: O15296
Synonyme:: 15-lipoxygenase 2;15-LOX-2;15-LOX-B;15S-lipoxygenase;arachidonate 15-lipoxygenase 2;arachidonate 15-lipoxygenase type II;arachidonate 15-lipoxygenase, second type;arachidonate omega(6) lipoxygenase;linoleate 13-lipoxygenase 15-LOb;polyunsaturated fatty acid lipoxygenase ALOX15B
Weitere Details:: This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.

Versandbedingungen:: Blue Ice