ALOX15 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6864
Zusätzliche Namen:: 12-LOX|15-LOX|15-LOX-1|ALOX15|LOG15
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGY
Uniprot:: P16050
Synonyme:: 12-LOX;12/15-lipoxygenase;15-lipooxygenase-1;15-lipoxygenase type 1;15-LOX;15-LOX type 1;15-LOX-1;arachidonate 12-lipoxygenase, leukocyte-type;arachidonate omega-6 lipoxygenase;hepoxilin A3 synthase Alox15;linoleate 13S-lipoxygenase;LOG15;polyunsaturated fatty acid lipoxygenase ALOX15
Weitere Details:: This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The encoded enzyme and its reaction products have been shown to regulate inflammation and immunity. Multiple pseudogenes of this gene have been identified in the human genome.