A6853
UBE2T Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6853
- Zusätzliche Namen:
- FANCT|HSPC150|PIG50|UBE2T
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
- Uniprot:
- Q9NPD8
- Synonyme:
- cell proliferation-inducing gene 50 protein;E2 ubiquitin-conjugating enzyme T;FANCT;HSPC150;HSPC150 protein similar to ubiquitin-conjugating enzyme;PIG50;ubiquitin carrier protein T;ubiquitin conjugating enzyme E2T;ubiquitin-conjugating enzyme E2 T;ubiquitin-conjugating enzyme E2T (putative);ubiquitin-protein ligase T
- Weitere Details:
- The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice