A6846
RECQL4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6846
- Zusätzliche Namen:
- RECQ4|RECQL4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA
- Uniprot:
- O94761
- Synonyme:
- ATP-dependent DNA helicase Q4;DNA helicase, RecQ-like type 4;DNA helicase, RecQ-like, type 4;RecQ helicase-like 4;RecQ protein-like 4;RECQ4;RTS
- Weitere Details:
- The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes.
- Versandbedingungen:
- Blue Ice