CDKN1C/p57 Kip2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A6843
Zusätzliche Namen:: BWCR|BWS|CDKN1C/p57 Kip2|KIP2|p57|p57Kip2|WBS
Anwendung:: ELISA, WB
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
Uniprot:: P49918
Synonyme:: BWCR;BWS;cyclin-dependent kinase inhibitor 1C;cyclin-dependent kinase inhibitor 1C (p57, Kip2);cyclin-dependent kinase inhibitor p57;KIP2;p57;p57Kip2;WBS
Weitere Details:: This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.