POLR2F Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6837
Zusätzliche Namen:: HRBP14.4|POLR2F|POLRF|RPABC14.4|RPABC2|RPB14.4|RPB6|RPC15
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Uniprot:: P61218
Synonyme:: DNA-directed RNA polymerase II subunit F;DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide;DNA-directed RNA polymerases I, II, and III subunit RPABC2;HRBP14.4;POLRF;polymerase (RNA) II (DNA directed) polypeptide F;polymerase (RNA) II subunit F;RNA Polymerase II subunit 14.4 kD;RNA polymerase II subunit F;RNA polymerases I, II, and III subunit ABC2;RPABC14.4;RPABC2;RPB14.4;RPB6;RPB6 homolog;RPC15
Weitere Details:: This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants.