A6832
LMO2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A6832
- Zusätzliche Namen:
- LMO-2|LMO2|RBTN2|RBTNL1|RHOM2|TTG2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKR
- Uniprot:
- P25791
- Synonyme:
- cysteine-rich protein TTG-2;LIM domain only protein 2;LMO-2;RBTN2;RBTNL1;RHOM2;rhombotin-2;rhombotin-like 1;T-cell translocation gene 2;T-cell translocation protein 2;TTG2
- Weitere Details:
- LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice