PDE5A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6831
Zusätzliche Namen:: CGB-PDE|CN5A|PDE5|PDE5A
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS
Uniprot:: O76074
Synonyme:: CGB-PDE;cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase;cGMP-binding cGMP-specific phosphodiesterase;cGMP-specific 3',5'-cyclic phosphodiesterase;cGMP-specific phosphodiesterase PDE5A2;cGMP-specific phosphodiesterase type 5A;CN5A;PDE5;phosphodiesterase 5A, cGMP-specific;phosphodiesterase isozyme 5
Weitere Details:: This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.