A6812
FANCL Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6812
- Zusätzliche Namen:
- FAAP43|FANCL|PHF9|POG
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLG
- Uniprot:
- Q9NW38
- Synonyme:
- E3 ubiquitin-protein ligase FANCL;FAAP43;Fanconi anemia complementation group L;fanconi anemia group L protein;fanconi anemia-associated polypeptide of 43 kDa;PHD finger protein 9;PHF9;POG;RING-type E3 ubiquitin transferase FANCL
- Weitere Details:
- This gene encodes a ubiquitin ligase that is a member of the Fanconi anemia complementation group (FANC). Members of this group are related by their assembly into a common nuclear protein complex rather than by sequence similarity. This gene encodes the protein for complementation group L that mediates monoubiquitination of FANCD2 as well as FANCI. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

