NEK2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A6811
Zusätzliche Namen:: HsPK21|NEK2|NEK2A|NLK1|PPP1R111|RP67
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITK
Uniprot:: P51955
Synonyme:: HSPK 21;HsPK21;NEK2A;Never in mitosis A-related kinase 2;NIMA (never in mitosis gene a)-related kinase 2;nimA-like protein kinase 1;nimA-related protein kinase 2;NLK1;PPP1R111;protein phosphatase 1, regulatory subunit 111;RP67;serine/threonine-protein kinase Nek2
Weitere Details:: This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.