Bcl9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6795
Zusätzliche Namen:: 2610202E01Rik|8030475K17Rik|A330041G23Rik|Bcl9|Gm130
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 160kDa/170kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DQAPRMGLALPGMGGPGPVGTPDIPLGTSPSMPGHNPMRPPAFLQQGMMGPHHRMMSPAQSTVPGPATLMTNPAAAVGMIPGKDRGPAGLYTHPGPVGSP
Uniprot:: Q9D219
Synonyme:: 2610202E01Rik;8030475K17Rik;A330041G23Rik;B cell CLL/lymphoma 9;B-cell CLL/lymphoma 9 protein;B-cell lymphoma 9 protein;bcl-9;Gm130;LGS;nuclear co-factor of beta-catenin signalling;protein legless homolog
Weitere Details:: Enables beta-catenin binding activity. Acts upstream of or within several processes, including myotube differentiation involved in skeletal muscle regeneration; skeletal muscle cell differentiation; and somatic stem cell population maintenance. Located in cis-Golgi network and nucleus. Is expressed in several structures, including brain; eye; head surface ectoderm; metanephros; and thymus primordium. Orthologous to human BCL9 (BCL9 transcription coactivator).