UQCRFS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6784
Zusätzliche Namen:: MC3DN10|RIP1|RIS1|RISP|UQCR5|UQCRFS1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Uniprot:: P47985
Synonyme:: complex III subunit 5;cytochrome b-c1 complex subunit 5;cytochrome b-c1 complex subunit Rieske, mitochondrial;epididymis secretory sperm binding protein;MC3DN10;Rieske iron-sulfur protein;Rieske protein UQCRFS1;RIP1;RIS1;RISP;ubiquinol-cytochrome c reductase iron-sulfur subunit;UQCR5
Weitere Details:: Predicted to enable oxidoreductase activity. Involved in mitochondrial respiratory chain complex III assembly and respiratory electron transport chain. Located in mitochondrion. Part of mitochondrial respiratory chain complex III and mitochondrial respiratory chain complex IV. Implicated in mitochondrial complex III deficiency.