TAF1C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6759
Zusätzliche Namen:: MGC:39976|SL1|TAF1C|TAFI110|TAFI95
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PPLIDPWDPGLTARDLLFRGGYRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGETLLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSP
Uniprot:: Q15572
Synonyme:: MGC:39976;RNA polymerase I-specific TBP-associated factor 110 kDa;SL1;SL1, 110kD subunit;TAFI110;TAFI95;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa;TATA box-binding protein-associated factor 1C;TATA box-binding protein-associated factor RNA polymerase I subunit C;TATA-box binding protein associated factor, RNA polymerase I, C;TBP-associated factor 1C;transcription factor SL1;transcription initiation factor SL1/TIF-IB subunit C
Weitere Details:: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Versandbedingungen:: Blue Ice