ST8SIA4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6754
Zusätzliche Namen:: PST|PST1|SIAT8D|ST8SIA-IV|ST8SIA4
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Uniprot:: Q92187
Synonyme:: alpha-2,8-sialyltransferase 8D;CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase;CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase;polysialyltransferase-1;PST;PST1;sialyltransferase 8 (alpha-2, 8-polysialytransferase) D;sialyltransferase 8D;sialyltransferase St8Sia IV;sialytransferase St8Sia IV;SIAT8-D;SIAT8D;ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 4;ST8SIA-IV;ST8SiaIV
Weitere Details:: The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice