ST3GAL3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6753
Zusätzliche Namen:: DEE15|EIEE15|MRT12|SIAT6|ST3Gal III|ST3GAL3|ST3GALII|ST3GalIII|ST3N
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Uniprot:: Q11203
Synonyme:: alpha 2,3-sialyltransferase III;alpha 2,3-ST 3;alpha-2,3-sialyltransferase II;Beta-galactoside alpha-2,3-sialyltransferase 3;CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase;DEE15;EIEE15;Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase;Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase;MRT12;N-acetyllactosaminide alpha-2,3-sialyltransferase;Sialyltransferase 6;sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase);sialyltransferase 6 (N-acetyllactosaminide alpha 2,3-sialyltransferase);SIAT6;ST3Gal III;ST3GALII;ST3GalIII;ST3N
Weitere Details:: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with a form of autosomal recessive nonsymdromic cognitive disability as well as infantile epileptic encephalopathy. Multiple transcript variants encoding several different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice