SNAP91 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6746
Zusätzliche Namen:: AP180|CALM|SNAP91
Anwendung:: ELISA, WB
Molekulargewicht:: 180kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPAGGATAWGGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL
Uniprot:: O60641
Synonyme:: 91 kDa synaptosomal-associated protein;AP180;assembly protein, 180kDa;CALM;clathrin coat assembly protein AP180;clathrin coat-associated protein AP180;phosphoprotein F1-20;synaptosomal-associated protein, 91kDa homolog;synaptosome associated protein 91kDa
Weitere Details:: Predicted to enable several functions, including SNARE binding activity; clathrin binding activity; and phosphatidylinositol binding activity. Acts upstream of or within regulation of clathrin-dependent endocytosis. Predicted to be located in several cellular components, including postsynaptic density; presynaptic endosome; and presynaptic membrane. Predicted to be extrinsic component of endosome membrane. Predicted to be active in several cellular components, including Schaffer collateral - CA1 synapse; cytoplasmic vesicle; and parallel fiber to Purkinje cell synapse. Predicted to be extrinsic component of presynaptic endocytic zone membrane. Biomarker of Alzheimer's disease.

Versandbedingungen:: Blue Ice