RECK Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6718
Zusätzliche Namen:: RECK|ST15
Anwendung:: ELISA, WB
Molekulargewicht:: 106kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP
Uniprot:: O95980
Synonyme:: membrane-anchored glycoprotein (metastasis and invasion);reversion-inducing cysteine-rich protein with Kazal motifs;ST15;suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein with kazal motifs);suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein with kazal motifs);suppressor of tumorigenicity 15 protein
Weitere Details:: The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.