RAMP3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6715
Zusätzliche Namen:: RAMP3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
Uniprot:: O60896
Synonyme:: calcitonin receptor-like receptor activity modifying protein 3;Calcitonin-receptor-like receptor activity-modifying protein 3;CRLR activity-modifying protein 3;receptor (calcitonin) activity modifying protein 3;receptor (G protein-coupled) activity modifying protein 3;receptor activity-modifying protein 3
Weitere Details:: The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor.

Versandbedingungen:: Blue Ice