A6712
RAB4A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6712
- Zusätzliche Namen:
- HRES-1|HRES-1/RAB4|HRES1|RAB4|RAB4A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENEL
- Uniprot:
- P20338
- Synonyme:
- HRES-1;HRES-1/RAB4;HRES1;HTLV-1 related endogenous sequence;RAB4;ras-related protein Rab-4A
- Weitere Details:
- This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene.
- Versandbedingungen:
- Blue Ice

