A6694
PNPLA3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6694
- Zusätzliche Namen:
- ADPN|C22orf20|iPLA(2)epsilon|PNPLA3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 53kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
- Uniprot:
- Q9NST1
- Synonyme:
- 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3;acylglycerol O-acyltransferase;acylglycerol transacylase;adiponutrin;ADPN;C22orf20;calcium-independent phospholipase A2-epsilon;iPLA(2)epsilon;iPLA2-epsilon;iPLA2epsilon;lysophosphatidic acid acyltransferase;patatin-like phospholipase domain-containing protein 3
- Weitere Details:
- The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.
- Versandbedingungen:
- Blue Ice