PDXK Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6687
Zusätzliche Namen:: C21orf124|C21orf97|HEL-S-1a|HMSN6C|PDXK|PKH|PNK|PRED79
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Uniprot:: O00764
Synonyme:: C21orf124;C21orf97;epididymis secretory sperm binding protein Li 1a;HEL-S-1a;HMSN6C;PKH;PNK;PRED79;pyridoxal (pyridoxine, vitamin B6) kinase;pyridoxal kinase;pyridoxamine kinase;pyridoxine kinase;vitamin B6 kinase
Weitere Details:: The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.