A6685
[KO Validated] PDCD6 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A6685
- Zusätzliche Namen:
- ALG-2|ALG2|D6|PEF1B
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
- Uniprot:
- O75340
- Synonyme:
- ALG-2;ALG2;apoptosis-linked gene 2 protein homolog;PEF1B;probable calcium-binding protein ALG-2;programmed cell death protein 6
- Weitere Details:
- This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5.
- Versandbedingungen:
- Blue Ice
![[KO Validated] PDCD6 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6685/A6685_1.jpg)
![[KO Validated] PDCD6 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6685/A6685_2.jpg)
![[KO Validated] PDCD6 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6685/A6685_P3055_KO-WB_01.jpg)
![[KO Validated] PDCD6 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6685/A6685_P3055_IP_01.jpg)